Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE3 Peptide - C-terminal region

SPDYE3 Peptide - C-terminal region

Product Specifications

UniProt

A6NKU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDYE3 Rabbit Polyclonal Antibody (orb583740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRFLAWDKDLRVSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A5 Polyclonal Antibody
MBS9133681-01 0.02 mL

SLC2A5 Polyclonal Antibody

Sign In for Pricing
View Details
SLC2A5 Polyclonal Antibody
MBS9133681-02 0.1 mL

SLC2A5 Polyclonal Antibody

Sign In for Pricing
View Details
SLC2A5 Polyclonal Antibody
MBS9133681-03 5x 0.1 mL

SLC2A5 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human MCP-4 (CCL13)
Z100649 1 mg

Recombinant Human MCP-4 (CCL13)

Sign In for Pricing
View Details
Olfr891 (NM_146478) Mouse Tagged Lenti ORF Clone
MR212935L4 10 µg

Olfr891 (NM_146478) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NALP1 (NLRP1) (NM_001033053) Human 3' UTR Clone
SC205602 10 µg

NALP1 (NLRP1) (NM_001033053) Human 3' UTR Clone

Sign In for Pricing
View Details