Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC18A1 Peptide - N-terminal region

SLC18A1 Peptide - N-terminal region

Product Specifications

UniProt

Q96GL6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC18A1 Rabbit Polyclonal Antibody (orb326247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Didodecyl phthalate
FD182847-01 0.25 g

Didodecyl phthalate

Sign In for Pricing
View Details
Didodecyl phthalate
FD182847-02 1 g

Didodecyl phthalate

Sign In for Pricing
View Details
Didodecyl phthalate
FD182847-03 5 g

Didodecyl phthalate

Sign In for Pricing
View Details
Didodecyl phthalate
FD182847-04 10 g

Didodecyl phthalate

Sign In for Pricing
View Details
Didodecyl phthalate
FD182847-05 25 g

Didodecyl phthalate

Sign In for Pricing
View Details
Andarine (GTx-007) 50mg
A10076-50 50 mg

Andarine (GTx-007) 50mg

Sign In for Pricing
View Details