SLC18A1 Peptide - N-terminal region
SLC18A1 Peptide - N-terminal region
Product Specifications
UniProt
Q96GL6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC18A1 Rabbit Polyclonal Antibody (orb326247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1471775-01 0.5 mg (E-Coli)
Recombinant Arabidopsis thaliana Putative cysteine-rich receptor-like protein kinase 32 (CRK32), partial
Sign In for Pricing
View Details MBS1471775-02 0.05 mg (Baculovirus)
Recombinant Arabidopsis thaliana Putative cysteine-rich receptor-like protein kinase 32 (CRK32), partial
Sign In for Pricing
View Details MBS1471775-03 0.5 mg (Yeast)
Recombinant Arabidopsis thaliana Putative cysteine-rich receptor-like protein kinase 32 (CRK32), partial
Sign In for Pricing
View Details MBS1471775-04 0.05 mg (Mammalian-Cell)
Recombinant Arabidopsis thaliana Putative cysteine-rich receptor-like protein kinase 32 (CRK32), partial
Sign In for Pricing
View Details MBS1471775-05 1 mg (E-Coli)
Recombinant Arabidopsis thaliana Putative cysteine-rich receptor-like protein kinase 32 (CRK32), partial
Sign In for Pricing
View Details MBS1471775-06 0.1 mg (Baculovirus)
Recombinant Arabidopsis thaliana Putative cysteine-rich receptor-like protein kinase 32 (CRK32), partial
Sign In for Pricing
View Details