Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KNG1 Peptide - N-terminal region

KNG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BDK, KNG

UniProt

C9JEX1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KNG1 Rabbit Polyclonal Antibody (orb584254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159923

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM1 (Phosphoglucomutase-1, Glucose Phosphomutase 1) (MaxLight 405) discontinued
131215-ML405 100 µL

PGM1 (Phosphoglucomutase-1, Glucose Phosphomutase 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Rtn4rl1 shRNA (UAS) - Lentiviral mouse Rtn4rl1 shRNA (UAS, iRFP) plasmid
GTR15277984 1 Vial

Lentiviral mouse Rtn4rl1 shRNA (UAS) - Lentiviral mouse Rtn4rl1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Thrombospondin-2 Antibody (MM0568-9T19) [DyLight 350]
NBP2-11923UV 0.1 mL

Mouse Monoclonal Thrombospondin-2 Antibody (MM0568-9T19) [DyLight 350]

Sign In for Pricing
View Details
Human Olfactory receptor 4C15 (OR4C15) ELISA kit
GTR10438750 96 Well

Human Olfactory receptor 4C15 (OR4C15) ELISA kit

Sign In for Pricing
View Details
PCDHGB2 (Protocadherin gamma-B2, PCDH-gamma-B2, MGC126854, PCDH-GAMMA-B2) (MaxLight 750) discontinued
130981-ML750 100 µL

PCDHGB2 (Protocadherin gamma-B2, PCDH-gamma-B2, MGC126854, PCDH-GAMMA-B2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Fra-2 shRNA (h) Lentiviral Particles
sc-35407-V 200 µL

Fra-2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details