Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KNG1 Peptide - N-terminal region

KNG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BDK, KNG

UniProt

C9JEX1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KNG1 Rabbit Polyclonal Antibody (orb584254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159923

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal OCT4 Antibody (OCT4/3508) [DyLight 680]
NBP3-14147FR 0.1 mL

Mouse Monoclonal OCT4 Antibody (OCT4/3508) [DyLight 680]

Sign In for Pricing
View Details
Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody
MBS2032524-01 0.1 mL

Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody

Sign In for Pricing
View Details
Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody
MBS2032524-02 0.2 mL

Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody

Sign In for Pricing
View Details
Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody
MBS2032524-03 0.5 mL

Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody

Sign In for Pricing
View Details
Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody
MBS2032524-04 1 mL

Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody

Sign In for Pricing
View Details
Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody
MBS2032524-05 5 mL

Macrophage Receptor With Collagenous Structure (MARCO) Polyclonal Antibody

Sign In for Pricing
View Details