Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYRIP Peptide - C-terminal region

MYRIP Peptide - C-terminal region

Product Specifications

UniProt

Q8NFW9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYRIP Rabbit Polyclonal Antibody (orb584337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKERKGTTKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse RBM27 (KIAA1311), Rabbit Polyclonal
MKA1311 Inquire

Anti-Mouse RBM27 (KIAA1311), Rabbit Polyclonal

Sign In for Pricing
View Details
PDGFR-α (phospho Tyr762) Rabbit Polyclonal Antibody
E28PP0992 100 µL

PDGFR-α (phospho Tyr762) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 1 (GSTA1) Antibody (HRP)
abx314149-01 20 µg

Glutathione S Transferase Alpha 1 (GSTA1) Antibody (HRP)

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 1 (GSTA1) Antibody (HRP)
abx314149-02 50 µg

Glutathione S Transferase Alpha 1 (GSTA1) Antibody (HRP)

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 1 (GSTA1) Antibody (HRP)
abx314149-03 100 µg

Glutathione S Transferase Alpha 1 (GSTA1) Antibody (HRP)

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 1 (GSTA1) Antibody (HRP)
abx314149-04 200 µg

Glutathione S Transferase Alpha 1 (GSTA1) Antibody (HRP)

Sign In for Pricing
View Details