Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYRIP Peptide - C-terminal region

MYRIP Peptide - C-terminal region

Product Specifications

UniProt

Q8NFW9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYRIP Rabbit Polyclonal Antibody (orb584337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKERKGTTKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A38 Antibody, FITC conjugated
CSB-PA846607LC01HU-01 50 µg

SLC25A38 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC25A38 Antibody, FITC conjugated
CSB-PA846607LC01HU-02 100 µg

SLC25A38 Antibody, FITC conjugated

Sign In for Pricing
View Details
PCMV-USP13-3xMyc-Neo Plasmid
PVT77463 2 µg

PCMV-USP13-3xMyc-Neo Plasmid

Sign In for Pricing
View Details
Anti-FAS/CD95 antibody
PAab03017 100 µg

Anti-FAS/CD95 antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS9243494-01 0.1 mL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS9243494-02 5x 0.1 mL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details