Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A11 Peptide - C-terminal region

SLC6A11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GAT-3, GAT3, GAT4

UniProt

P48066

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A11 Rabbit Polyclonal Antibody (orb331053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055044

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38072124 3x 1.0µg DNA

PTEN CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
BICD1 AAV siRNA Pooled Vector
13319161 1.0 µg

BICD1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
3- (9-anthryl) -1- (2-naphthyl) prop-2-en-1-one
OR27832 1 Each

3- (9-anthryl) -1- (2-naphthyl) prop-2-en-1-one

Sign In for Pricing
View Details
Rabbit Monoclonal FOXL2 Antibody (FOXL2/7989R) [CoraFluor 1]
NBP3-20964CL1 0.1 mL

Rabbit Monoclonal FOXL2 Antibody (FOXL2/7989R) [CoraFluor 1]

Sign In for Pricing
View Details
DUSP12 (Dual-specificity Protein Phosphatase 12, Dual Specificity Tyrosine Phosphatase YVH1) (PE)
126052-PE 100 µL

DUSP12 (Dual-specificity Protein Phosphatase 12, Dual Specificity Tyrosine Phosphatase YVH1) (PE)

Sign In for Pricing
View Details
Proteinase 3 (Proteinase-3, PR3, PR-3, PRTN3, ACPA, Azurophil Granule Protein 7, AGP7, cANCA, c-ANCA Antigen, EC 3.4.21.76, Leukocyte Proteinase 3, MBT, Myeloblastin, MBN, Neutrophil Proteinase 4, NP4, NP-4, p29, Wegener Autoantigen) (PE) discontinued
138264-PE 100 µL

Proteinase 3 (Proteinase-3, PR3, PR-3, PRTN3, ACPA, Azurophil Granule Protein 7, AGP7, cANCA, c-ANCA Antigen, EC 3.4.21.76, Leukocyte Proteinase 3, MBT, Myeloblastin, MBN, Neutrophil Proteinase 4, NP4, NP-4, p29, Wegener Autoantigen) (PE) discontinued

Sign In for Pricing
View Details