Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A11 Peptide - C-terminal region

SLC6A11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GAT-3, GAT3, GAT4

UniProt

P48066

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A11 Rabbit Polyclonal Antibody (orb331053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055044

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ERAL1 knockout cell line
ABC-KH4873 1 Vial

Human ERAL1 knockout cell line

Sign In for Pricing
View Details
APPL1 (DCC-interacting Protein 13-alpha, Dip13-alpha, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 1, APPL, DIP13A, KIAA1428) (MaxLight 750) discontinued
123450-ML750 100 µL

APPL1 (DCC-interacting Protein 13-alpha, Dip13-alpha, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 1, APPL, DIP13A, KIAA1428) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TBL1X Antibody
KC-29751-01 50 μL

TBL1X Antibody

Sign In for Pricing
View Details
TBL1X Antibody
KC-29751-02 100 µL

TBL1X Antibody

Sign In for Pricing
View Details
TBL1X Antibody
KC-29751-03 1 mL

TBL1X Antibody

Sign In for Pricing
View Details
Recombinant human ARH3/ADPRS protein
ATGP1665-500 500 µg

Recombinant human ARH3/ADPRS protein

Sign In for Pricing
View Details