Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLRC5 Peptide - N-terminal region

NLRC5 Peptide - N-terminal region

Product Specifications

UniProt

Q86WI3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NLRC5 Rabbit Polyclonal Antibody (orb584695) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vars2 (NM_175137) Mouse Tagged ORF Clone Lentiviral Particle
MR219019L3V 200 µL

Vars2 (NM_175137) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SMPDL3B CRISPRa sgRNA lentivector (set of three targets)(Mouse)
44473124 3x 1.0µg DNA

SMPDL3B CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
NLRP7 Polyclonal Antibody, PE Conjugated
bs-6866R-PE 100 µL

NLRP7 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
DCP1A Antibody
E18-0551-2 100 µg -100 µL

DCP1A Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human EDNRA (Endothelin receptor type A) Full Length
MPC0084K Each

Magic™ Membrane Protein Human EDNRA (Endothelin receptor type A) Full Length

Sign In for Pricing
View Details
Soyasapogenol C
AAA59514-01 10 mg

Soyasapogenol C

Sign In for Pricing
View Details