Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tom1l1 Peptide - N-terminal region

Tom1l1 Peptide - N-terminal region

Product Specifications

UniProt

Q923U0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOM1L1 Rabbit Polyclonal Antibody (orb585144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INTTQDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken alpha-Thromboglobulin ELISA Kit
MBS006223 Inquire

Chicken alpha-Thromboglobulin ELISA Kit

Sign In for Pricing
View Details
Lentiviral human C11orf24 shRNA (UAS) - Lentiviral human C11orf24 shRNA (UAS, RFP) (25)
GTR15146039 1 Vial

Lentiviral human C11orf24 shRNA (UAS) - Lentiviral human C11orf24 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PLA2R (PLA2R1) Human Over-expression Lysate
orb1362783 20 µg

PLA2R (PLA2R1) Human Over-expression Lysate

Sign In for Pricing
View Details
Gamma-actin Antibody
251971 0.1 mg

Gamma-actin Antibody

Sign In for Pricing
View Details
Mouse Monoclonal SFMBT2 Antibody (PCRP-SFMBT2-1B7) [FITC]
NBP3-24306F 0.1 mL

Mouse Monoclonal SFMBT2 Antibody (PCRP-SFMBT2-1B7) [FITC]

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Chaperone protein DnaK (dnaK), partial
MBS1222705 Inquire

Recombinant Neisseria meningitidis serogroup C Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details