Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tom1l1 Peptide - N-terminal region

Tom1l1 Peptide - N-terminal region

Product Specifications

UniProt

Q923U0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOM1L1 Rabbit Polyclonal Antibody (orb585144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INTTQDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDRKH Recombinant Protein (Mouse)
RP178079 100 µg

TDRKH Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)
MBS1318225-01 0.02 mg (E-Coli)

Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details
Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)
MBS1318225-02 0.1 mg (E-Coli)

Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details
Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)
MBS1318225-03 0.02 mg (Yeast)

Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details
Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)
MBS1318225-04 0.1 mg (Yeast)

Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details
Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)
MBS1318225-05 0.02 mg (Baculovirus)

Recombinant Bartonella quintana Probable chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details