Ift74 Peptide - middle region
Ift74 Peptide - middle region
Product Specifications
Product Name Alternative
Ccdc2
UniProt
Q5XIR2
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ift74 Rabbit Polyclonal Antibody (orb331165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001007002
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NMSPEKQVKYIEMKTTNEKLLQELDTLQQQLDSLNIKKESLETEIAHSQV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1118039-01 0.02 mg (E-Coli)
Recombinant Burkholderia pseudomallei Co-chaperone protein hscB homolog (hscB)
Sign In for Pricing
View Details MBS1118039-02 0.1 mg (E-Coli)
Recombinant Burkholderia pseudomallei Co-chaperone protein hscB homolog (hscB)
Sign In for Pricing
View Details MBS1118039-03 0.02 mg (Yeast)
Recombinant Burkholderia pseudomallei Co-chaperone protein hscB homolog (hscB)
Sign In for Pricing
View Details MBS1118039-04 0.1 mg (Yeast)
Recombinant Burkholderia pseudomallei Co-chaperone protein hscB homolog (hscB)
Sign In for Pricing
View Details MBS1118039-05 0.02 mg (Baculovirus)
Recombinant Burkholderia pseudomallei Co-chaperone protein hscB homolog (hscB)
Sign In for Pricing
View Details MBS1118039-06 0.02 mg (Mammalian-Cell)
Recombinant Burkholderia pseudomallei Co-chaperone protein hscB homolog (hscB)
Sign In for Pricing
View Details