Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS33A Peptide - middle region

VPS33A Peptide - middle region

Product Specifications

UniProt

Q96AX1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_075067

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GW 766994
585164 1.0mg

GW 766994

Sign In for Pricing
View Details
Fancb (NM_001146081) Mouse Tagged ORF Clone
MG219831 10 µg

Fancb (NM_001146081) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Musk (NM_031061) Rat Untagged Clone
RN210003 10 µg

Musk (NM_031061) Rat Untagged Clone

Sign In for Pricing
View Details
Zfp58 AAV Vector (Mouse) (CMV)
51032104 1 µg

Zfp58 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Mouse Lipocalin-2/NGAL MAb (Clone 228421)
MAB18571-SP 25 µg

Mouse Lipocalin-2/NGAL MAb (Clone 228421)

Sign In for Pricing
View Details
Camk4 (NM_009793) Mouse Tagged Lenti ORF Clone
MR207505L4 10 µg

Camk4 (NM_009793) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details