CTNNBL1 Peptide - C-terminal region
CTNNBL1 Peptide - C-terminal region
Product Specifications
UniProt
Q8WYA6
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CTNNBL1 Rabbit Polyclonal Antibody (orb585259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AMIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740159-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-BC-K783-M-01 48 T (32 samples)
Phospholipase D (PLD) Activity Colorimetric Assay Kit
Sign In for Pricing
View Details E-BC-K783-M-02 96 T (80 samples)
Phospholipase D (PLD) Activity Colorimetric Assay Kit
Sign In for Pricing
View Details