Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC45B Peptide - C-terminal region

UNC45B Peptide - C-terminal region

Product Specifications

UniProt

Q8IWX7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UNC45B Rabbit Polyclonal Antibody (orb331180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVNCTNSYDVKEVIPELVQLAKFSKQHVPEEHPKDKKDFIDMRVKRLLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSTr1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
45554124 3x 1.0µg DNA

SSTr1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
TRNAE17 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV751660 1.0 µg DNA

TRNAE17 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Histone H1.4 (H1-4) Antibody
abx343182-01 20 µL

Histone H1.4 (H1-4) Antibody

Sign In for Pricing
View Details
Histone H1.4 (H1-4) Antibody
abx343182-02 50 µL

Histone H1.4 (H1-4) Antibody

Sign In for Pricing
View Details
Histone H1.4 (H1-4) Antibody
abx343182-03 100 µL

Histone H1.4 (H1-4) Antibody

Sign In for Pricing
View Details
Histone H1.4 (H1-4) Antibody
abx343182-04 200 µL

Histone H1.4 (H1-4) Antibody

Sign In for Pricing
View Details