Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC45B Peptide - C-terminal region

UNC45B Peptide - C-terminal region

Product Specifications

UniProt

Q8IWX7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UNC45B Rabbit Polyclonal Antibody (orb331180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVNCTNSYDVKEVIPELVQLAKFSKQHVPEEHPKDKKDFIDMRVKRLLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Microalbumin,MALB ELISA KIT
JOT-EK3454Hu-01 96 Well

Human Microalbumin,MALB ELISA KIT

Sign In for Pricing
View Details
Human Microalbumin,MALB ELISA KIT
JOT-EK3454Hu-02 48 Well

Human Microalbumin,MALB ELISA KIT

Sign In for Pricing
View Details
CLTA Rabbit pAb
E2503793 100 µL

CLTA Rabbit pAb

Sign In for Pricing
View Details
OR5J2 (NM_001005492) Human Over-expression Lysate
LH03555V 100 µg

OR5J2 (NM_001005492) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Dystroglycan Antibody [Janelia Fluor 646]
NBP3-00292JF646 0.1 mL

Rabbit Polyclonal Dystroglycan Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Zcchc17 (NM_153160) Mouse Recombinant Protein
TP502973 20 µg

Zcchc17 (NM_153160) Mouse Recombinant Protein

Sign In for Pricing
View Details