DEPTOR Peptide - middle region
DEPTOR Peptide - middle region
Product Specifications
UniProt
E7EV87
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DEPTOR Rabbit Polyclonal Antibody (orb585319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
133715-ML750 100 µL
SOX13 (SRY (Sex Determining Region Y) -box 13 Transcription Factor SOX-13, Islet Cell Antigen 12, ICA12, Type 1 Diabetes Autoantigen ICA12) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
PB9912-iFluor647 100 µg
Anti-ZP2 Antibody Picoband® (iFluor647 Conjugate)
Sign In for Pricing
View Details 