DEPTOR Peptide - middle region
DEPTOR Peptide - middle region
Product Specifications
UniProt
E7EV87
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DEPTOR Rabbit Polyclonal Antibody (orb585319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2648855 200 µL
Trypanosoma brucei brucei Kinetoplast DNA-associated protein/DNA Rabbit Polyclonal Antibody (PE)
Sign In for Pricing
View Details 
T5400-43F-APC 100 µL
Thyroid Stimulating Hormone (TSH, Thyrotropin beta, TSH-beta, TSH-B, TSHB) (APC) discontinued
Sign In for Pricing
View Details