Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNK Peptide - C-terminal region

IFNK Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-27J8.1

UniProt

Q9P0W0

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNK Rabbit Polyclonal Antibody (orb326427) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064509

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC7 Protein Vector (Human) (pPM-C-HA)
PV002519 500 ng

ARMC7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Quick Step Rat Resistin ELISA Kit
QS0618Ra-01 48 Tests

Quick Step Rat Resistin ELISA Kit

Sign In for Pricing
View Details
Quick Step Rat Resistin ELISA Kit
QS0618Ra-02 96 Tests

Quick Step Rat Resistin ELISA Kit

Sign In for Pricing
View Details
C15orf48 ORF Vector (Human) (pORF)
13895011 1.0 µg DNA

C15orf48 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SYCE2, NT (SYCE2, CESC1, Synaptonemal complex central element protein 2, Central element synaptonemal complex protein 1)
MBS646827-01 0.2 mL

SYCE2, NT (SYCE2, CESC1, Synaptonemal complex central element protein 2, Central element synaptonemal complex protein 1)

Sign In for Pricing
View Details
SYCE2, NT (SYCE2, CESC1, Synaptonemal complex central element protein 2, Central element synaptonemal complex protein 1)
MBS646827-02 5x 0.2 mL

SYCE2, NT (SYCE2, CESC1, Synaptonemal complex central element protein 2, Central element synaptonemal complex protein 1)

Sign In for Pricing
View Details