Mpp6 Peptide - C-terminal region
Mpp6 Peptide - C-terminal region
Product Specifications
UniProt
Q9JLB0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mpp6 Rabbit Polyclonal Antibody (orb585409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042791-ML405 100 µL
TGM5, CT (TGM5, TGMX, Protein-glutamine gamma-glutamyltransferase 5, Transglutaminase X, Transglutaminase-5) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
GTR15133931 1 Vial
Lentiviral mouse Mnx1 shRNA (UAS) - Lentiviral mouse Mnx1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details