Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mpp6 Peptide - C-terminal region

Mpp6 Peptide - C-terminal region

Product Specifications

UniProt

Q9JLB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mpp6 Rabbit Polyclonal Antibody (orb585409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNT siRNA (Human)
MBS8215580-01 15 nmol

PCNT siRNA (Human)

Sign In for Pricing
View Details
PCNT siRNA (Human)
MBS8215580-02 30 nmol

PCNT siRNA (Human)

Sign In for Pricing
View Details
PCNT siRNA (Human)
MBS8215580-03 5x 30 nmol

PCNT siRNA (Human)

Sign In for Pricing
View Details
PMP 500 mL Low Form Beaker
BEA1315 6 / PCK

PMP 500 mL Low Form Beaker

Sign In for Pricing
View Details
Lamin B1 Antibody
MBS9435580-01 0.05 mL

Lamin B1 Antibody

Sign In for Pricing
View Details
Lamin B1 Antibody
MBS9435580-02 0.1 mL

Lamin B1 Antibody

Sign In for Pricing
View Details