Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIF3L1 Peptide - C-terminal region

NIF3L1 Peptide - C-terminal region

Product Specifications

UniProt

Q6X734

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIF3L1 Rabbit Polyclonal Antibody (orb331196) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKVMSAVKGIDGVSVTSFSARTGNEEQTRINLNCTQKALMQVVDFLSRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ppp1r37 shRNA (UAS) - Lentiviral mouse Ppp1r37 shRNA (UAS, iRFP) plasmid
GTR15267808 1 Vial

Lentiviral mouse Ppp1r37 shRNA (UAS) - Lentiviral mouse Ppp1r37 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Vimentin (VIM) (Biotin)
135256-Biotin 100 µL

Vimentin (VIM) (Biotin)

Sign In for Pricing
View Details
Dopamine Transporter (DAT) (APC) discontinued
D9020-05-APC 100 µL

Dopamine Transporter (DAT) (APC) discontinued

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-4441 Vector
mh31433 500 ng

LentimiRa-Off-hsa-miR-4441 Vector

Sign In for Pricing
View Details
PRDX3 Recombinant Monoclonal Antibody [14E2]
A74541-100 100 µL

PRDX3 Recombinant Monoclonal Antibody [14E2]

Sign In for Pricing
View Details
Mouse Monoclonal p41 Flagellin Antibody (6802) [PE]
NBP3-08849PE 0.1 mL

Mouse Monoclonal p41 Flagellin Antibody (6802) [PE]

Sign In for Pricing
View Details