Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIF3L1 Peptide - C-terminal region

NIF3L1 Peptide - C-terminal region

Product Specifications

UniProt

Q6X734

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIF3L1 Rabbit Polyclonal Antibody (orb331196) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKVMSAVKGIDGVSVTSFSARTGNEEQTRINLNCTQKALMQVVDFLSRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neutrophil Extracellular Traps (H3cit NETs) ELISA Kit
abx392607 96 Tests

Human Neutrophil Extracellular Traps (H3cit NETs) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Complexin-2 (Cplx2)
MBS965908-01 0.02 mg (E-Coli)

Recombinant Mouse Complexin-2 (Cplx2)

Sign In for Pricing
View Details
Recombinant Mouse Complexin-2 (Cplx2)
MBS965908-02 0.1 mg (E-Coli)

Recombinant Mouse Complexin-2 (Cplx2)

Sign In for Pricing
View Details
Recombinant Mouse Complexin-2 (Cplx2)
MBS965908-03 0.02 mg (Yeast)

Recombinant Mouse Complexin-2 (Cplx2)

Sign In for Pricing
View Details
Recombinant Mouse Complexin-2 (Cplx2)
MBS965908-04 0.1 mg (Yeast)

Recombinant Mouse Complexin-2 (Cplx2)

Sign In for Pricing
View Details
Recombinant Mouse Complexin-2 (Cplx2)
MBS965908-05 0.02 mg (Baculovirus)

Recombinant Mouse Complexin-2 (Cplx2)

Sign In for Pricing
View Details