Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPATCH4 Peptide - N-terminal region

GPATCH4 Peptide - N-terminal region

Product Specifications

UniProt

Q5T3I0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPATCH4 Rabbit Polyclonal Antibody (orb585432) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Metallothionein-2 Protein, GST, E.coli-500ug
QP8894-ec-500ug 500ug

Recombinant Human Metallothionein-2 Protein, GST, E.coli-500ug

Sign In for Pricing
View Details
Bovine Collagen Purified 5gm
IBOCLG5GM 5 g

Bovine Collagen Purified 5gm

Sign In for Pricing
View Details
CANT1 Protein Vector (Mouse) (pPB-N-His)
PV161331 500 ng

CANT1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Renin (REN) (NM_000537) Human Tagged ORF Clone Lentiviral Particle
RC208382L4V 200 µL

Renin (REN) (NM_000537) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal GGT1 Antibody [Alexa Fluor 350]
NBP2-98975AF350 0.1 mL

Rabbit Polyclonal GGT1 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
CTD Nuclear envelope phosphatase 1 (HRP)
312265-01 50 µg

CTD Nuclear envelope phosphatase 1 (HRP)

Sign In for Pricing
View Details