Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPATCH4 Peptide - N-terminal region

GPATCH4 Peptide - N-terminal region

Product Specifications

UniProt

Q5T3I0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPATCH4 Rabbit Polyclonal Antibody (orb585432) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp780b CRISPRa sgRNA lentivector (set of three targets)(Mouse)
51128124 3x 1.0µg DNA

Zfp780b CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
SMC3 Rabbit monoclonal antibody
E43S40461 100 µL

SMC3 Rabbit monoclonal antibody

Sign In for Pricing
View Details
KRTAP9-2 Protein Lysate
OCOA07695-20UG 20 µg

KRTAP9-2 Protein Lysate

Sign In for Pricing
View Details
ZNF117 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
51297061 1.0 µg DNA

ZNF117 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
2-Ethylmercapto-5-carbethoxy-4-thiocyanopyrimidine
E12100 5 g

2-Ethylmercapto-5-carbethoxy-4-thiocyanopyrimidine

Sign In for Pricing
View Details
Endothelial cell-specific Molecule 1 (ESM1) Rat ELISA Kit
D1711 96 Tests

Endothelial cell-specific Molecule 1 (ESM1) Rat ELISA Kit

Sign In for Pricing
View Details