PRPF18 Peptide - middle region
PRPF18 Peptide - middle region
Product Specifications
Product Name Alternative
PRP18, hPrp18
UniProt
Q99633
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRPF18 Rabbit Polyclonal Antibody (orb585462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003666
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F0019-96E-APC 200 µL
Fascin, ID (Singed-like Protein, 55kD Actin-bundling Protein, p55, SNL, HSN, FAN1, FSCN1) (APC) discontinued
Sign In for Pricing
View Details