Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF18 Peptide - middle region

PRPF18 Peptide - middle region

Product Specifications

Product Name Alternative

PRP18, hPrp18

UniProt

Q99633

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPF18 Rabbit Polyclonal Antibody (orb585462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003666

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium avium Adenosine deaminase (add)
MBS1239359-01 0.02 mg (E-Coli)

Recombinant Mycobacterium avium Adenosine deaminase (add)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Adenosine deaminase (add)
MBS1239359-02 0.02 mg (Yeast)

Recombinant Mycobacterium avium Adenosine deaminase (add)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Adenosine deaminase (add)
MBS1239359-03 0.1 mg (E-Coli)

Recombinant Mycobacterium avium Adenosine deaminase (add)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Adenosine deaminase (add)
MBS1239359-04 0.1 mg (Yeast)

Recombinant Mycobacterium avium Adenosine deaminase (add)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Adenosine deaminase (add)
MBS1239359-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium avium Adenosine deaminase (add)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Adenosine deaminase (add)
MBS1239359-06 0.02 mg (Mammalian-Cell)

Recombinant Mycobacterium avium Adenosine deaminase (add)

Sign In for Pricing
View Details