Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Peptide - N-terminal region

SNTB2 Peptide - N-terminal region

Product Specifications

UniProt

Q13425

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNTB2 Rabbit Polyclonal Antibody (orb326452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp74 (NM_001271339) Rat Tagged ORF Clone
RR217101 10 µg

Zfp74 (NM_001271339) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PA28, alpha, CT (Proteasome Activator 28-alpha subunit) (AP) discontinued
P1700-AP 100 µL

PA28, alpha, CT (Proteasome Activator 28-alpha subunit) (AP) discontinued

Sign In for Pricing
View Details
Anti-Phospho-FOXO3A (Ser253) Rabbit Monoclonal Antibody
MA4405-.1 100 µL

Anti-Phospho-FOXO3A (Ser253) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SOX6 Rabbit Polyclonal Antibody (Fluoro550)
orb3109389 100 µg

SOX6 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Mouse POC5 siRNA
abx929124-01 15 nmol

Mouse POC5 siRNA

Sign In for Pricing
View Details
Mouse POC5 siRNA
abx929124-02 30 nmol

Mouse POC5 siRNA

Sign In for Pricing
View Details