Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Peptide - N-terminal region

SNTB2 Peptide - N-terminal region

Product Specifications

UniProt

Q13425

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNTB2 Rabbit Polyclonal Antibody (orb326452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNE1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV685438 1.0 µg DNA

CCNE1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
IL-4 human rec., 20 μg
BS.WF.65.0020 20 μg

IL-4 human rec., 20 μg

Sign In for Pricing
View Details
Ammecr1l (NM_001242430) Mouse Untagged Clone
MC227419 10 µg

Ammecr1l (NM_001242430) Mouse Untagged Clone

Sign In for Pricing
View Details
DNA-Directed RNA Polymerase III Subunit RPC9 (CRCP) Antibody
abx231955 100 µg

DNA-Directed RNA Polymerase III Subunit RPC9 (CRCP) Antibody

Sign In for Pricing
View Details
N-Pentane "Dry" AR 99.0%
604985 500 mL

N-Pentane "Dry" AR 99.0%

Sign In for Pricing
View Details
CITED1 Rabbit pAb, BF594 conjugated
orb3001894 100 µL

CITED1 Rabbit pAb, BF594 conjugated

Sign In for Pricing
View Details