Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Peptide - N-terminal region

SNTB2 Peptide - N-terminal region

Product Specifications

UniProt

Q13425

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNTB2 Rabbit Polyclonal Antibody (orb326452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse IL-17A Antibody
MBS4514617-01 20 Tests

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse IL-17A Antibody
MBS4514617-02 50 Tests

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse IL-17A Antibody
MBS4514617-03 100 Tests

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse IL-17A Antibody
MBS4514617-04 200 Tests

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse IL-17A Antibody
MBS4514617-05 5x 200 Tests

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
2-Amino-5-Ethylphenol Hydrochloride
OR1010281-01 1 g

2-Amino-5-Ethylphenol Hydrochloride

Sign In for Pricing
View Details