Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Peptide - N-terminal region

SNTB2 Peptide - N-terminal region

Product Specifications

UniProt

Q13425

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNTB2 Rabbit Polyclonal Antibody (orb326452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PTPIP51 Antibody [Janelia Fluor 549]
NBP1-47294JF549 0.1 mL

Rabbit Polyclonal PTPIP51 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
C7orf26 Human shRNA Plasmid Kit (Locus ID 79034)
TL305771 1 Kit

C7orf26 Human shRNA Plasmid Kit (Locus ID 79034)

Sign In for Pricing
View Details
Phospho-P53 (Ser315) Rabbit Polyclonal Antibody (BF488)
orb1573708 100 µL

Phospho-P53 (Ser315) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
XAGE1A (NM_001097592) Human Tagged ORF Clone Lentiviral Particle
RC221189L4V 200 µL

XAGE1A (NM_001097592) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Clathrin heavy chain Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-2932R-APC-Cy5.5 100 µL

Clathrin heavy chain Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
ZNF155, CT (ZNF155, Zinc finger protein 155) (MaxLight 750) discontinued
044136-ML750 100 µL

ZNF155, CT (ZNF155, Zinc finger protein 155) (MaxLight 750) discontinued

Sign In for Pricing
View Details