Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDC3 Peptide - C-terminal region

SDC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SDCN, SYND3

UniProt

O75056

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDC3 Rabbit Polyclonal Antibody (orb585581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055469

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGGVVGALFAAFLVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEF

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARG1 Mouse mAb Antibody
orb3064760-01 50 µL

ARG1 Mouse mAb Antibody

Sign In for Pricing
View Details
ARG1 Mouse mAb Antibody
orb3064760-02 100 µL

ARG1 Mouse mAb Antibody

Sign In for Pricing
View Details
Hsd17b6 3'UTR Luciferase Stable Cell Line
TU109769 1.0 mL

Hsd17b6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cytokeratin 15 (KRT15) Rabbit pAb (APR24900N)
APR24900N-01 50 µL

Cytokeratin 15 (KRT15) Rabbit pAb (APR24900N)

Sign In for Pricing
View Details
Cytokeratin 15 (KRT15) Rabbit pAb (APR24900N)
APR24900N-02 100 µL

Cytokeratin 15 (KRT15) Rabbit pAb (APR24900N)

Sign In for Pricing
View Details
Cytokeratin 15 (KRT15) Rabbit pAb (APR24900N)
APR24900N-03 200 µL

Cytokeratin 15 (KRT15) Rabbit pAb (APR24900N)

Sign In for Pricing
View Details