SDC3 Peptide - C-terminal region
SDC3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SDCN, SYND3
UniProt
O75056
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SDC3 Rabbit Polyclonal Antibody (orb585581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055469
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VGGVVGALFAAFLVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEF
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2266405 3x 1.0 µg
SPANXN3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
GTR15244445 1 Vial
Lentiviral mouse Vmn2r85 shRNA (UAS) - Lentiviral mouse Vmn2r85 shRNA (UAS) (25)
Sign In for Pricing
View Details 
PA89746HU-01 50 µg
Rabbit Anti-Human Olfactory receptor 2I1 Polyclonal Antibody
Sign In for Pricing
View Details 
PA89746HU-02 100 µg
Rabbit Anti-Human Olfactory receptor 2I1 Polyclonal Antibody
Sign In for Pricing
View Details PA89746HU-03 500 µg
Rabbit Anti-Human Olfactory receptor 2I1 Polyclonal Antibody
Sign In for Pricing
View Details PA89746HU-04 1 mg
Rabbit Anti-Human Olfactory receptor 2I1 Polyclonal Antibody
Sign In for Pricing
View Details