Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KEL Peptide - N-terminal region

KEL Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD238, ECE3

UniProt

P23276

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KEL Rabbit Polyclonal Antibody (orb585585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000411

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 (NM_001242) Human Recombinant Protein
TP304252L 1 mg

CD27 (NM_001242) Human Recombinant Protein

Sign In for Pricing
View Details
CDC42SE2 Mouse Monoclonal Antibody [Clone ID: OTI10A5]
CF808200 100 µg

CDC42SE2 Mouse Monoclonal Antibody [Clone ID: OTI10A5]

Sign In for Pricing
View Details
Human ANGPTL4 Antibody Pair Set
E-KAB-0218 50 µL & 100 µg

Human ANGPTL4 Antibody Pair Set

Sign In for Pricing
View Details
Prucalopride Succinate
TRC-P838950-500MG 500 mg

Prucalopride Succinate

Sign In for Pricing
View Details
Human COL7 (Collagen Type VII) ELISA Kit
E-EL-H0781-01 24 Tests

Human COL7 (Collagen Type VII) ELISA Kit

Sign In for Pricing
View Details
Human COL7 (Collagen Type VII) ELISA Kit
E-EL-H0781-02 48 Tests

Human COL7 (Collagen Type VII) ELISA Kit

Sign In for Pricing
View Details