KEL Peptide - N-terminal region
KEL Peptide - N-terminal region
Product Specifications
Product Name Alternative
CD238, ECE3
UniProt
P23276
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KEL Rabbit Polyclonal Antibody (orb585585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000411
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC423780 20 µg
Olfactory receptor 10X1 (OR10X1) (NM_001004477) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC743243-100 1x 100 µL
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3243), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
