Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSG1 Peptide - C-terminal region

DSG1 Peptide - C-terminal region

Product Specifications

UniProt

B7Z845

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DSG1 Rabbit Polyclonal Antibody (orb585611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Neuromedin S Antibody
MBS9239466-01 0.05 mL

Anti-Neuromedin S Antibody

Sign In for Pricing
View Details
Anti-Neuromedin S Antibody
MBS9239466-02 0.1 mL

Anti-Neuromedin S Antibody

Sign In for Pricing
View Details
Anti-Neuromedin S Antibody
MBS9239466-03 5x 0.1 mL

Anti-Neuromedin S Antibody

Sign In for Pricing
View Details
Gspt1 3'UTR Lenti-reporter-Luc Vector
22740084 1.0 µg

Gspt1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TRAJ1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV787231 1.0 µg DNA

TRAJ1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rat CD59 Protein (C-His, Rat)
P517854 100 µg

Rat CD59 Protein (C-His, Rat)

Sign In for Pricing
View Details