Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSG1 Peptide - C-terminal region

DSG1 Peptide - C-terminal region

Product Specifications

UniProt

B7Z845

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DSG1 Rabbit Polyclonal Antibody (orb585611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPD+SAGM SBTTB500ML Triple, Blow Molding Technology
SBTTB500 -S-01 1 Each

CPD+SAGM SBTTB500ML Triple, Blow Molding Technology

Sign In for Pricing
View Details
CPD+SAGM SBTTB500ML Triple, Blow Molding Technology
SBTTB500 -S-02 1 Each

CPD+SAGM SBTTB500ML Triple, Blow Molding Technology

Sign In for Pricing
View Details
Human TWISTNB Knockout A549 cell line
GTR15410584 1 Vial

Human TWISTNB Knockout A549 cell line

Sign In for Pricing
View Details
Phospho-eIF4EBP1 (Thr36) Rabbit Polyclonal Antibody (APC)
orb992895 100 µL

Phospho-eIF4EBP1 (Thr36) Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rat soluble cluster of differentiation 14,sCD14 ELISA KIT
JOT-EK0404Ra-01 96 Well

Rat soluble cluster of differentiation 14,sCD14 ELISA KIT

Sign In for Pricing
View Details
Rat soluble cluster of differentiation 14,sCD14 ELISA KIT
JOT-EK0404Ra-02 48 Well

Rat soluble cluster of differentiation 14,sCD14 ELISA KIT

Sign In for Pricing
View Details