Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1E Peptide - C-terminal region

CD1E Peptide - C-terminal region

Product Specifications

UniProt

P15812

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD1E Rabbit Polyclonal Antibody (orb585636) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3a-Hydroxy-5a-Androst-16-ene
TRC-H798290-500MG 500 mg

3a-Hydroxy-5a-Androst-16-ene

Sign In for Pricing
View Details
MET Rat Monoclonal Antibody [Clone ID: BCI-3E7]
AM32986PU-N 100 µg

MET Rat Monoclonal Antibody [Clone ID: BCI-3E7]

Sign In for Pricing
View Details
HDGF Recombinant Rabbit Monoclonal Antibody [JE56-90]
HA720013 100 µL

HDGF Recombinant Rabbit Monoclonal Antibody [JE56-90]

Sign In for Pricing
View Details
1700010D01Rik Mouse Gene Knockout Kit (CRISPR)
KN500074 1 Kit

1700010D01Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
n-Octyl-Xanthate, Potassium Salt
TRC-O297000-50MG 50 mg

n-Octyl-Xanthate, Potassium Salt

Sign In for Pricing
View Details
Human ARHGEF33 activation kit by CRISPRa
GA119197 1 Kit

Human ARHGEF33 activation kit by CRISPRa

Sign In for Pricing
View Details