CD1E Peptide - C-terminal region
CD1E Peptide - C-terminal region
Product Specifications
UniProt
P15812
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD1E Rabbit Polyclonal Antibody (orb585636) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-ATF4-Hu-01 96 Tests
Human Activating Transcription Factor 4 (ATF4) ELISA Kit
Sign In for Pricing
View Details RD-ATF4-Hu-02 48 Tests
Human Activating Transcription Factor 4 (ATF4) ELISA Kit
Sign In for Pricing
View Details 