Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB5 Peptide - C-terminal region

LILRB5 Peptide - C-terminal region

Product Specifications

UniProt

O75023

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRB5 Rabbit Polyclonal Antibody (orb326475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR52B2 Antibody
8G457-AAT 50 µg

OR52B2 Antibody

Sign In for Pricing
View Details
Epinephrine Sulfonic Acid-d3
TRC-E588607-1MG 1 mg

Epinephrine Sulfonic Acid-d3

Sign In for Pricing
View Details
RALGPS1 Polyclonal Antibody
E-AB-90964-01 60 µL

RALGPS1 Polyclonal Antibody

Sign In for Pricing
View Details
RALGPS1 Polyclonal Antibody
E-AB-90964-02 120 µL

RALGPS1 Polyclonal Antibody

Sign In for Pricing
View Details
RALGPS1 Polyclonal Antibody
E-AB-90964-03 200 µL

RALGPS1 Polyclonal Antibody

Sign In for Pricing
View Details
Aggrecan (ACAN) Rabbit Polyclonal Antibody
TA367617 100 µL

Aggrecan (ACAN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details