Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB5 Peptide - C-terminal region

LILRB5 Peptide - C-terminal region

Product Specifications

UniProt

O75023

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRB5 Rabbit Polyclonal Antibody (orb326475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), 1mg/mL
BNUM1388-50 1x 50 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), 1mg/mL

Sign In for Pricing
View Details
Recombinant Human ITPase/ITPA Protein (His Tag)
PKSH032588-01 10 µg

Recombinant Human ITPase/ITPA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ITPase/ITPA Protein (His Tag)
PKSH032588-02 50 µg

Recombinant Human ITPase/ITPA Protein (His Tag)

Sign In for Pricing
View Details
p27 KIP 1 (CDKN1B) Rabbit Monoclonal Antibody [Clone ID: R09-6C3]
TA383979 100 µL

p27 KIP 1 (CDKN1B) Rabbit Monoclonal Antibody [Clone ID: R09-6C3]

Sign In for Pricing
View Details
Mouse Tspan2 activation kit by CRISPRa
GA208607 1 Kit

Mouse Tspan2 activation kit by CRISPRa

Sign In for Pricing
View Details
Colorimeter BMET-806
BMET-806 1 Unit

Colorimeter BMET-806

Sign In for Pricing
View Details