IL3RA Peptide - middle region
IL3RA Peptide - middle region
Product Specifications
UniProt
P26951
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL3RA Rabbit Polyclonal Antibody (orb585754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1167939-01 0.02 mg (E-Coli)
Recombinant Paracoccus denitrificans Biotin synthase 1 (bioB1)
Sign In for Pricing
View Details MBS1167939-02 0.02 mg (Yeast)
Recombinant Paracoccus denitrificans Biotin synthase 1 (bioB1)
Sign In for Pricing
View Details 
MBS1167939-03 0.1 mg (E-Coli)
Recombinant Paracoccus denitrificans Biotin synthase 1 (bioB1)
Sign In for Pricing
View Details MBS1167939-04 0.1 mg (Yeast)
Recombinant Paracoccus denitrificans Biotin synthase 1 (bioB1)
Sign In for Pricing
View Details