IL3RA Peptide - middle region
IL3RA Peptide - middle region
Product Specifications
UniProt
P26951
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL3RA Rabbit Polyclonal Antibody (orb585754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10363611 96 Well
Mouse Carbonic anhydrase related protein (CA8) ELISA Kit
Sign In for Pricing
View Details GTR10426594 96 Well
Rat intestinal fatty acid binding protein, iFABP ELISA Kit
Sign In for Pricing
View Details