UNC13D Peptide - C-terminal region
UNC13D Peptide - C-terminal region
Product Specifications
Product Name Alternative
FHL3, HLH3, HPLH3, Munc13-4
UniProt
Q70J99
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UNC13D Rabbit Polyclonal Antibody (orb585901) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_954712
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
978561 960 pieces per CAR
Rack with 96 Cryo.s, biobanking, 1000μl, polypropylene, with manual capping tool, with screw cap, STERILE, 2D code, 960 pieces per CAR
Sign In for Pricing
View Details DHE28701 100 μg
Research Grade Anti-Human PMEL17/ME20M Antibody (DYP688)
Sign In for Pricing
View Details