UNC13D Peptide - C-terminal region
UNC13D Peptide - C-terminal region
Product Specifications
Product Name Alternative
FHL3, HLH3, HPLH3, Munc13-4
UniProt
Q70J99
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UNC13D Rabbit Polyclonal Antibody (orb585901) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_954712
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
253516-ML650 100 µL
YWHAG (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, gamma Polypeptide, 14-3-3GAMMA) (MaxLight 650)
Sign In for Pricing
View Details 