UNC5C Peptide - middle region
UNC5C Peptide - middle region
Product Specifications
UniProt
O95185
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UNC5C Rabbit Polyclonal Antibody (orb331271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M00189-carrier-free 100 µL
Anti-Argonaute 2 AGO2 Rabbit Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details 