Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC5C Peptide - middle region

UNC5C Peptide - middle region

Product Specifications

UniProt

O95185

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UNC5C Rabbit Polyclonal Antibody (orb331271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRNP70 Protein Vector (Mouse) (pPB-N-His)
PV232315 500 ng

SNRNP70 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
DiaEasy™ Dialyzer (800 µl) MWCO 1 kDa
K1017-10 10 Tubes

DiaEasy™ Dialyzer (800 µl) MWCO 1 kDa

Sign In for Pricing
View Details
FRMPD1 Antibody Blocking Peptide
orb1501393 500 µg

FRMPD1 Antibody Blocking Peptide

Sign In for Pricing
View Details
BTNL8 Rabbit Polyclonal Antibody
orb580907 100 µL

BTNL8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Parvalbumin Antibody FL594 Conjugate
75-455-FL594 200 µL

Anti-Parvalbumin Antibody FL594 Conjugate

Sign In for Pricing
View Details
p38 (pY182) Blocking Peptide
MBS8243945-01 1 mg

p38 (pY182) Blocking Peptide

Sign In for Pricing
View Details