Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM65 Peptide - C-terminal region

TMEM65 Peptide - C-terminal region

Product Specifications

UniProt

Q6PI78

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM65 Rabbit Polyclonal Antibody (orb587242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919267

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTPKQVDMWQTRLSTHLGKAVGVTIGCILGMFPLIFFGGGEEDEKLETKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIN1, glutamate receptor, ionotropic, N-methyl D-aspartate 1, NMDA1, NMDAR1, NR1, N-methyl-D-aspartate receptor channel, subunit zeta-1, NMDA receptor 1, glutamate [NMDA] receptor subunit zeta 1NMDA 1 Receptor, C1 Splice Variant (NMDA R1, N-methyl-D-aspartate) (PE) discontinued
N2904-PE 100 µL

GRIN1, glutamate receptor, ionotropic, N-methyl D-aspartate 1, NMDA1, NMDAR1, NR1, N-methyl-D-aspartate receptor channel, subunit zeta-1, NMDA receptor 1, glutamate [NMDA] receptor subunit zeta 1NMDA 1 Receptor, C1 Splice Variant (NMDA R1, N-methyl-D-aspartate) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal Cdc20 Antibody (CDC20/7026R) [Alexa Fluor 532]
NBP3-14078AF532 0.1 mL

Rabbit Monoclonal Cdc20 Antibody (CDC20/7026R) [Alexa Fluor 532]

Sign In for Pricing
View Details
Stat5b CRISPR Activation Plasmid (m2)
sc-423179-ACT-2 20 µg

Stat5b CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Human Ficolin-3 Protein - (Dry Ice)
H00008547-P01-10ug 10 µg

Recombinant Human Ficolin-3 Protein - (Dry Ice)

Sign In for Pricing
View Details
ZKSCAN3 Protein Vector (Rat) (pPM-C-HA)
PV318280 500 ng

ZKSCAN3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human ASPA Recombinant Protein
PROTP45381-500ug 500 µg

Human ASPA Recombinant Protein

Sign In for Pricing
View Details