TMEM65 Peptide - C-terminal region
TMEM65 Peptide - C-terminal region
Product Specifications
UniProt
Q6PI78
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM65 Rabbit Polyclonal Antibody (orb587242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_919267
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTPKQVDMWQTRLSTHLGKAVGVTIGCILGMFPLIFFGGGEEDEKLETKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6372501-01 0.1 mL
CCL11 (Eotaxin, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (FITC)
Sign In for Pricing
View Details MBS6372501-02 5x 0.1 mL
CCL11 (Eotaxin, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (FITC)
Sign In for Pricing
View Details 12899126 3x 1.0µg DNA
Axl CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details