USP54 Peptide - C-terminal region
USP54 Peptide - C-terminal region
Product Specifications
UniProt
Q70EL1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with USP54 Rabbit Polyclonal Antibody (orb326881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TPGPRRVDMPPDDDWRQSSYASHSGHRRTVGEGFLFVLSDAPRREQIRAR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC427560 20 µg
BIGM103 (SLC39A8) (NM_001135147) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC941850-100 1x 100 µL
PD-L2 / PDCD1LG2 / CD273 (PDL2/1850), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 