Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF573 Peptide - middle region

ZNF573 Peptide - middle region

Product Specifications

UniProt

Q86YE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF573 Rabbit Polyclonal Antibody (orb575844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGHLRIHQRVHTGEKPYKCKECGKTFSRRSNLVEHGQFHTDEKPYICEKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD95 Antibody
DL21895F-01 20 Tests

PE/Cyanine7 Anti-Human CD95 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD95 Antibody
DL21895F-02 50 Tests

PE/Cyanine7 Anti-Human CD95 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD95 Antibody
DL21895F-03 100 Tests

PE/Cyanine7 Anti-Human CD95 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD95 Antibody
DL21895F-04 200 Tests

PE/Cyanine7 Anti-Human CD95 Antibody

Sign In for Pricing
View Details
BRCA1 (NM_007294) Human Mutant ORF Clone
RC403027 10 µg

BRCA1 (NM_007294) Human Mutant ORF Clone

Sign In for Pricing
View Details
PRG2 cDNA Clone
MBS1275196-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

PRG2 cDNA Clone

Sign In for Pricing
View Details